ASB6 anticorps (Middle Region)

N° du produit ABIN634452

Détail du produit anti-ASB6 anticorps

Antigène: ASB6 (Ankyrin Repeat and SOCS Box Containing 6 (ASB6))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ASB6 est non-conjugé

Application: Western Blotting (WB)

Specificité: ASB6 antibody was raised against the middle region of ASB6

Purification: Affinity purified

Immunogène: ASB6 antibody was raised using the middle region of ASB6 corresponding to a region with amino acids LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ASB6 Blocking Peptide, catalog no. 33R-5090, is also available for use as a blocking control in assays to test for specificity of this ASB6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ASB6

Antigène: ASB6 (Ankyrin Repeat and SOCS Box Containing 6 (ASB6))

Autre désignation: ASB6 (ASB6 Produits)

Synonymes: anticorps zgc:110231, anticorps 2510004M11Rik, anticorps AA409356, anticorps ankyrin repeat and SOCS box containing 6, anticorps ankyrin repeat and SOCS box containing 6 S homeolog, anticorps ankyrin repeat and SOCS box-containing 6, anticorps asb6, anticorps asb6.S, anticorps ASB6, anticorps Asb6

Sujet: ASB6 belongs to a family of ankyrin repeat proteins that, along with four other protein families, contain a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box, similar to the F-box, acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases.

Poids moléculaire: 46 kDa (MW of target protein)