OAS1 anticorps (N-Term)
-
- Antigène Voir toutes OAS1 Anticorps
- OAS1 (2',5'-Oligoadenylate Synthetase 1, 40/46kDa (OAS1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp OAS1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- OAS1 antibody was raised against the N terminal of OAS1
- Purification
- Affinity purified
- Immunogène
- OAS1 antibody was raised using the N terminal of OAS1 corresponding to a region with amino acids MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSS
- Top Product
- Discover our top product OAS1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
OAS1 Blocking Peptide, catalog no. 33R-6228, is also available for use as a blocking control in assays to test for specificity of this OAS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OAS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- OAS1 (2',5'-Oligoadenylate Synthetase 1, 40/46kDa (OAS1))
- Autre désignation
- OAS1 (OAS1 Produits)
- Synonymes
- anticorps OAS1, anticorps IFI-4, anticorps OIAS, anticorps OIASI, anticorps L3, anticorps Pp2a2, anticorps 2',5'-oligoadenylate synthetase 1, anticorps 2'-5'-oligoadenylate synthetase 1, anticorps 2'-5' oligoadenylate synthetase 1A, anticorps protein phosphatase 2 catalytic subunit beta, anticorps OAS1, anticorps Oas1a, anticorps Ppp2cb, anticorps Oas1
- Sujet
- This protein is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection.
- Poids moléculaire
- 42 kDa (MW of target protein)
- Pathways
- Hepatitis C
-