RBM9 anticorps (Middle Region)
-
- Antigène Voir toutes RBM9 Anticorps
- RBM9 (RNA Binding Motif Protein 9 (RBM9))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RBM9 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RBM9 antibody was raised against the middle region of RBM9
- Purification
- Affinity purified
- Immunogène
- RBM9 antibody was raised using the middle region of RBM9 corresponding to a region with amino acids PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT
- Top Product
- Discover our top product RBM9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RBM9 Blocking Peptide, catalog no. 33R-7280, is also available for use as a blocking control in assays to test for specificity of this RBM9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RBM9 (RNA Binding Motif Protein 9 (RBM9))
- Autre désignation
- RBM9 (RBM9 Produits)
- Synonymes
- anticorps rta, anticorps fox2, anticorps xrbm9, anticorps hrnbp2, anticorps MGC79813, anticorps RBM9, anticorps rbm9a, anticorps FOX2, anticorps Fox-2, anticorps HNRBP2, anticorps HRNBP2, anticorps RTA, anticorps dJ106I20.3, anticorps fxh, anticorps 2810460A15Rik, anticorps AA407676, anticorps AI118529, anticorps Fbm2, anticorps Fxh, anticorps Hrnbp2, anticorps Rbm9, anticorps rbm9, anticorps zgc:85694, anticorps fox-2, anticorps hnrbp2, anticorps rbfox2, anticorps rbm9-b, anticorps rbm9b, anticorps RNA binding protein, fox-1 homolog 2, anticorps RNA binding fox-1 homolog 2, anticorps RNA binding fox-1 homolog 2 L homeolog, anticorps RNA binding protein, fox-1 homolog (C. elegans) 2, anticorps RNA binding fox-1 homolog 2 S homeolog, anticorps RBFOX2, anticorps rbfox2, anticorps rbfox2.L, anticorps Rbfox2, anticorps rbfox2.S
- Sujet
- RBM9 is a RNA-binding protein that seems to act as a coregulatory factor of ER-alpha.
- Poids moléculaire
- 39 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway, Skeletal Muscle Fiber Development
-