AIMP1 anticorps

N° du produit ABIN634468

Détail du produit anti-AIMP1 anticorps

Antigène: AIMP1 (Aminoacyl tRNA Synthetase Complex-Interacting Multifunctional Protein 1 (AIMP1))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AIMP1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SCYE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLKEKAILQATLREEKKLRVENAKLKKEIEELKQELIQAEIQNGVKQIPF

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SCYE1 Blocking Peptide, catalog no. 33R-5153, is also available for use as a blocking control in assays to test for specificity of this SCYE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCYE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AIMP1

Antigène: AIMP1 (Aminoacyl tRNA Synthetase Complex-Interacting Multifunctional Protein 1 (AIMP1))

Autre désignation: SCYE1 (AIMP1 Produits)

Synonymes: anticorps EMAP2, anticorps EMAPII, anticorps HLD3, anticorps SCYE1, anticorps p43, anticorps wu:fa95a05, anticorps zgc:154081, anticorps AIMP1, anticorps 9830137A06Rik, anticorps AIMP1/p43, anticorps Emap2, anticorps Scye1, anticorps scye1, anticorps aminoacyl tRNA synthetase complex interacting multifunctional protein 1, anticorps aminoacyl tRNA synthetase complex-interacting multifunctional protein 1, anticorps aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 S homeolog, anticorps AIMP1, anticorps aimp1, anticorps Aimp1, anticorps aimp1.S

Sujet: SCYE1 is a cytokine that is specifically induced by apoptosis. The release of this cytokine renders the tumor-associated vasculature sensitive to tumor necrosis factor. The precursor of SCYE1 (pro-SCYE1) is identical to the p43 subunit, which is associated with the multi-tRNA synthetase complex. Therefore, pro-SCYE1 may function in binding RNA as part of the tRNA synthetase complex in normal cells and in stimulating inflammatory responses after proteolytic cleavage in tumor cells.

Poids moléculaire: 34 kDa (MW of target protein)