CFP anticorps (N-Term)

N° du produit ABIN634481

Détail du produit anti-CFP anticorps

Antigène: CFP (Complement Factor P (CFP))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CFP est non-conjugé

Application: Western Blotting (WB)

Specificité: CFP antibody was raised against the N terminal of CFP

Purification: Affinity purified

Immunogène: CFP antibody was raised using the N terminal of CFP corresponding to a region with amino acids QYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CFP Blocking Peptide, catalog no. 33R-7790, is also available for use as a blocking control in assays to test for specificity of this CFP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CFP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CFP

Antigène: CFP (Complement Factor P (CFP))

Autre désignation: CFP (CFP Produits)

Synonymes: anticorps BFD, anticorps PFC, anticorps PFD, anticorps PROPERDIN, anticorps BCFG, anticorps Pfc, anticorps Properdin, anticorps complement factor properdin, anticorps CFP, anticorps Cfp

Sujet: CFP is a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Système du Complément