CFP anticorps (N-Term)
-
- Antigène Voir toutes CFP Anticorps
- CFP (Complement Factor P (CFP))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CFP est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CFP antibody was raised against the N terminal of CFP
- Purification
- Affinity purified
- Immunogène
- CFP antibody was raised using the N terminal of CFP corresponding to a region with amino acids QYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWS
- Top Product
- Discover our top product CFP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CFP Blocking Peptide, catalog no. 33R-7790, is also available for use as a blocking control in assays to test for specificity of this CFP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CFP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CFP (Complement Factor P (CFP))
- Autre désignation
- CFP (CFP Produits)
- Synonymes
- anticorps BFD, anticorps PFC, anticorps PFD, anticorps PROPERDIN, anticorps BCFG, anticorps Pfc, anticorps Properdin, anticorps complement factor properdin, anticorps CFP, anticorps Cfp
- Sujet
- CFP is a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system.
- Poids moléculaire
- 48 kDa (MW of target protein)
- Pathways
- Système du Complément
-