SFTPD anticorps (Middle Region)
-
- Antigène Voir toutes SFTPD Anticorps
- SFTPD (Surfactant Protein D (SFTPD))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SFTPD est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SFTPD antibody was raised against the middle region of SFTPD
- Purification
- Affinity purified
- Immunogène
- SFTPD antibody was raised using the middle region of SFTPD corresponding to a region with amino acids PPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSA
- Top Product
- Discover our top product SFTPD Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SFTPD Blocking Peptide, catalog no. 33R-7253, is also available for use as a blocking control in assays to test for specificity of this SFTPD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFTPD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SFTPD (Surfactant Protein D (SFTPD))
- Autre désignation
- SFTPD (SFTPD Produits)
- Synonymes
- anticorps COLEC7, anticorps PSP-D, anticorps SFTP4, anticorps SP-D, anticorps BDE, anticorps BDSD, anticorps HOX4I, anticorps SPD, anticorps AI573415, anticorps Sftp4, anticorps surfactant protein D, anticorps homeobox D13, anticorps surfactant associated protein D, anticorps SFTPD, anticorps HOXD13, anticorps Sftpd, anticorps SP-D
- Sujet
- SFTPD contributes to the lung's defense against inhaled microorganisms. SFTPD may participate in the extracellular reorganization or turnover of pulmonary surfactant.
- Poids moléculaire
- 35 kDa (MW of target protein)
-