BPIFA1 anticorps (Middle Region)

N° du produit ABIN634486

Détail du produit anti-BPIFA1 anticorps

Antigène: BPIFA1 (BPI Fold Containing Family A, Member 1 (BPIFA1))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BPIFA1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PLUNC antibody was raised against the middle region of PLUNC

Purification: Affinity purified

Immunogène: PLUNC antibody was raised using the middle region of PLUNC corresponding to a region with amino acids GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASL

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLUNC Blocking Peptide, catalog no. 33R-3412, is also available for use as a blocking control in assays to test for specificity of this PLUNC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLUNC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BPIFA1

Antigène: BPIFA1 (BPI Fold Containing Family A, Member 1 (BPIFA1))

Autre désignation: PLUNC (BPIFA1 Produits)

Synonymes: anticorps LUNX, anticorps NASG, anticorps PLUNC, anticorps SPLUNC1, anticorps SPURT, anticorps bA49G10.5, anticorps Plunc, anticorps BPI fold containing family A member 1, anticorps BPI fold containing family A, member 1, anticorps BPIFA1, anticorps Bpifa1

Sujet: PLUNC is the human homolog of murine plunc and is specifically expressed in the upper airways and nasopharyngeal regions. The exact biological function of this protein is not known, however, it has been suggested to be involved in inflammatory responses to irritants in the upper airways. It may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer.

Poids moléculaire: 28 kDa (MW of target protein)