C4BPB anticorps (N-Term)

N° du produit ABIN634490

Détail du produit anti-C4BPB anticorps

Antigène: C4BPB (Complement Component 4 Binding Protein, beta (C4BPB))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C4BPB est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: C4 BPB antibody was raised against the N terminal of C4 PB

Purification: Affinity purified

Immunogène: C4 BPB antibody was raised using the N terminal of C4 PB corresponding to a region with amino acids CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C4BPB Blocking Peptide, catalog no. 33R-1652, is also available for use as a blocking control in assays to test for specificity of this C4BPB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 PB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C4BPB

Antigène: C4BPB (Complement Component 4 Binding Protein, beta (C4BPB))

Autre désignation: C4BPB (C4BPB Produits)

Synonymes: anticorps C4BPB, anticorps C4BP, anticorps C4bp-ps1, anticorps complement component 4 binding protein beta, anticorps complement component 4 binding protein, beta, anticorps C4BPB, anticorps C4bpb

Sujet: C4BPB is a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Système du Complément