MASP2 anticorps (N-Term)

N° du produit ABIN634492

Détail du produit anti-MASP2 anticorps

Antigène: MASP2 (Mannan-Binding Lectin serine Peptidase 2 (MASP2))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MASP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: MASP2 antibody was raised against the N terminal of MASP2

Purification: Affinity purified

Immunogène: MASP2 antibody was raised using the N terminal of MASP2 corresponding to a region with amino acids FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MASP2 Blocking Peptide, catalog no. 33R-3017, is also available for use as a blocking control in assays to test for specificity of this MASP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MASP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MASP2

Antigène: MASP2 (Mannan-Binding Lectin serine Peptidase 2 (MASP2))

Autre désignation: MASP2 (MASP2 Produits)

Synonymes: anticorps MAP19, anticorps MASP-2, anticorps MASP1P1, anticorps sMAP, anticorps MAp19, anticorps mannan binding lectin serine peptidase 2, anticorps mannan-binding lectin serine peptidase 2, anticorps MASP2, anticorps Masp2

Sujet: The Ra-reactive factor (RARF) is a complement-dependent bactericidal factor that binds to the Ra and R2 polysaccharides expressed by certain enterobacteria.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Système du Complément