CD40 anticorps (N-Term)
-
- Antigène Voir toutes CD40 Anticorps
- CD40
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CD40 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CD40 antibody was raised against the N terminal of CD40
- Purification
- Affinity purified
- Immunogène
- CD40 antibody was raised using the N terminal of CD40 corresponding to a region with amino acids SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD
- Top Product
- Discover our top product CD40 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CD40 Blocking Peptide, catalog no. 33R-8706, is also available for use as a blocking control in assays to test for specificity of this CD40 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD40 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CD40
- Autre désignation
- CD40 (CD40 Produits)
- Synonymes
- anticorps Bp50, anticorps CDW40, anticorps TNFRSF5, anticorps p50, anticorps AI326936, anticorps GP39, anticorps HIGM1, anticorps IGM, anticorps IMD3, anticorps T-BAM, anticorps TRAP, anticorps Tnfrsf5, anticorps TNFSF5, anticorps CD40 molecule, anticorps CD40 antigen, anticorps CD40, anticorps Cd40
- Sujet
- CD40 is the receptor for TNFSF5/CD40LG. Defects in CD40 are the cause of hyper-IgM immunodeficiency type 3 (HIGM3).
- Poids moléculaire
- 20 kDa (MW of target protein)
- Pathways
- Signalisation NF-kappaB, Cellular Response to Molecule of Bacterial Origin, M Phase, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Cancer Immune Checkpoints
-