Perforin 1 anticorps
-
- Antigène Voir toutes Perforin 1 (PRF1) Anticorps
- Perforin 1 (PRF1) (Perforin 1 (Pore Forming Protein) (PRF1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Perforin 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Perforin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKR
- Top Product
- Discover our top product PRF1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Perforin 1 Blocking Peptide, catalog no. 33R-8899, is also available for use as a blocking control in assays to test for specificity of this Perforin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Perforin 1 (PRF1) (Perforin 1 (Pore Forming Protein) (PRF1))
- Autre désignation
- Perforin 1 (PRF1 Produits)
- Synonymes
- anticorps FLH2, anticorps HPLH2, anticorps P1, anticorps PFN1, anticorps PFP, anticorps PRF1, anticorps Pfn, anticorps Pfp, anticorps Prf-1, anticorps Cyta, anticorps RATCYTA, anticorps LOC443187, anticorps perforin, anticorps prf1, anticorps cytolysin, anticorps perforin-1, anticorps perforin-1-like, anticorps perforin 1, anticorps perforin 1 (pore forming protein), anticorps perforin, anticorps perforin 1 L homeolog, anticorps PRF1, anticorps Prf1, anticorps LOC443187, anticorps prf1, anticorps prf1.L
- Sujet
- PRF1 has structural and functional similarities to complement component 9 (C9). Like C9, this protein creates transmembrane tubules and is capable of lysing non-specifically a variety of target cells. This protein is one of the main cytolytic proteins of cytolytic granules, and it is known to be a key effector molecule for T-cell- and natural killer-cell-mediated cytolysis. Defects in the gene encoding PRF1 cause familial hemophagocytic lymphohistiocytosis type 2 (HPLH2), a rare and lethal autosomal recessive disorder of early childhood.
- Poids moléculaire
- 59 kDa (MW of target protein)
- Pathways
- Apoptose, Caspase Cascade in Apoptosis
-