TRAF7 anticorps (N-Term)

N° du produit ABIN634504

Détail du produit anti-TRAF7 anticorps

Antigène: TRAF7 (TNF Receptor-Associated Factor 7 (TRAF7))

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRAF7 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRAF7 antibody was raised against the N terminal of TRAF7

Purification: Affinity purified

Immunogène: TRAF7 antibody was raised using the N terminal of TRAF7 corresponding to a region with amino acids GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEEDSMPPISTPR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRAF7 Blocking Peptide, catalog no. 33R-3462, is also available for use as a blocking control in assays to test for specificity of this TRAF7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAF7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRAF7

Antigène: TRAF7 (TNF Receptor-Associated Factor 7 (TRAF7))

Autre désignation: TRAF7 (TRAF7 Produits)

Synonymes: anticorps rfwd1, anticorps MGC52680, anticorps im:7149067, anticorps zgc:158391, anticorps RFWD1, anticorps RNF119, anticorps RGD1559653, anticorps TNF receptor associated factor 7 S homeolog, anticorps TNF receptor associated factor 7, anticorps TNF receptor-associated factor 7, anticorps traf7.S, anticorps TRAF7, anticorps traf7, anticorps Traf7

Sujet: Tumor necrosis factor (TNF) receptor-associated factors, such as TRAF7, are signal transducers for members of the TNF receptor superfamily.

Poids moléculaire: 74 kDa (MW of target protein)