DAP Kinase 1 anticorps (N-Term)

N° du produit ABIN634506

Détail du produit anti-DAP Kinase 1 anticorps

Antigène: DAP Kinase 1 (DAPK1) (Death-Associated Protein Kinase 1 (DAPK1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DAP Kinase 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: DAPK1 antibody was raised against the N terminal of DAPK1

Purification: Affinity purified

Immunogène: DAPK1 antibody was raised using the N terminal of DAPK1 corresponding to a region with amino acids MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DAPK1 Blocking Peptide, catalog no. 33R-6570, is also available for use as a blocking control in assays to test for specificity of this DAPK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAPK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DAP Kinase 1

Antigène: DAP Kinase 1 (DAPK1) (Death-Associated Protein Kinase 1 (DAPK1))

Autre désignation: DAPK1 (DAPK1 Produits)

Synonymes: anticorps DAPK1, anticorps MGC81366, anticorps si:ch211-66i11.1, anticorps wu:fj09c03, anticorps dapk, anticorps MGC83745, anticorps 2310039H24Rik, anticorps 2810425C21Rik, anticorps AI642003, anticorps D13Ucla1, anticorps DAP-Kinase, anticorps DAPK, anticorps death-associated protein kinase 1, anticorps death associated protein kinase 1 L homeolog, anticorps death associated protein kinase 1, anticorps death associated protein kinase 1 S homeolog, anticorps LOC427465, anticorps dapk1.L, anticorps DAPK1, anticorps dapk1, anticorps dapk1.S, anticorps Dapk1

Sujet: Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160 kDa calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consen

Poids moléculaire: 157 kDa (MW of target protein)

Pathways: Signalisation MAPK, Interferon-gamma Pathway