LGALS1/Galectin 1 anticorps
-
- Antigène Voir toutes LGALS1/Galectin 1 (LGALS1) Anticorps
- LGALS1/Galectin 1 (LGALS1) (Lectin, Galactoside-Binding, Soluble, 1 (LGALS1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LGALS1/Galectin 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- LGALS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM
- Top Product
- Discover our top product LGALS1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LGALS1 Blocking Peptide, catalog no. 33R-2676, is also available for use as a blocking control in assays to test for specificity of this LGALS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LGALS1/Galectin 1 (LGALS1) (Lectin, Galactoside-Binding, Soluble, 1 (LGALS1))
- Autre désignation
- LGALS1 (LGALS1 Produits)
- Synonymes
- anticorps GAL1, anticorps GBP, anticorps Galectin-1, anticorps LGAS1, anticorps LGALS1, anticorps MGC64502, anticorps GB10026, anticorps AA410090, anticorps Gal-1, anticorps Galbp, anticorps L-14.5, anticorps L14, anticorps Lect14, anticorps galectin-1, anticorps Galaptin, anticorps galectin 1, anticorps galectin-1, anticorps lectin, galactoside-binding, soluble, 1 L homeolog, anticorps protein enabled, anticorps lectin, galactose binding, soluble 1, anticorps LGALS1, anticorps Lgals1, anticorps CC1G_05003, anticorps CC1G_05004, anticorps lgals1.L, anticorps LOC408848
- Sujet
- The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS1 may act as an autocrine negative growth factor that regulates cell proliferation.
- Poids moléculaire
- 15 kDa (MW of target protein)
- Pathways
- Carbohydrate Homeostasis
-