GPR177/WLS anticorps (Middle Region)
-
- Antigène Voir toutes GPR177/WLS (WLS) Anticorps
- GPR177/WLS (WLS) (Wntless Homolog (WLS))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GPR177/WLS est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GPR177 antibody was raised against the middle region of GPR177
- Purification
- Affinity purified
- Immunogène
- GPR177 antibody was raised using the middle region of GPR177 corresponding to a region with amino acids DIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLE
- Top Product
- Discover our top product WLS Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GPR177 Blocking Peptide, catalog no. 33R-2005, is also available for use as a blocking control in assays to test for specificity of this GPR177 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR177 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GPR177/WLS (WLS) (Wntless Homolog (WLS))
- Autre désignation
- GPR177 (WLS Produits)
- Synonymes
- anticorps C1orf139, anticorps EVI, anticorps GPR177, anticorps MRP, anticorps mig-14, anticorps 5031439A09Rik, anticorps AI173978, anticorps AI987742, anticorps Gpr177, anticorps gpr117, anticorps gpr177, anticorps sb:cb610, anticorps wu:fb36d04, anticorps wu:fb44d10, anticorps wu:fb50c06, anticorps zgc:64091, anticorps CG6210, anticorps Dmel\\CG6210, anticorps Evi, anticorps Evi/Wls, anticorps Srt, anticorps Wls, anticorps Wls/Evi, anticorps evi, anticorps srt, anticorps wls/evi, anticorps wntless Wnt ligand secretion mediator, anticorps wntless homolog (Drosophila), anticorps wntless, anticorps WLS, anticorps Wls, anticorps wls
- Sujet
- GPR177 has signal transducer activity. It is positive regulation of I-kappaB kinase/NF-kappaB cascade.
- Poids moléculaire
- 62 kDa (MW of target protein)
- Pathways
- Signalisation WNT
-