ATL2 anticorps (C-Term)

N° du produit ABIN634521

Détail du produit anti-ATL2 anticorps

Antigène: ATL2 (Atlastin GTPase 2 (ATL2))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATL2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ARL6 IP2 antibody was raised against the C terminal of ARL6 P2

Purification: Affinity purified

Immunogène: ARL6 IP2 antibody was raised using the C terminal of ARL6 P2 corresponding to a region with amino acids MEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARL6IP2 Blocking Peptide, catalog no. 33R-5950, is also available for use as a blocking control in assays to test for specificity of this ARL6IP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL0 P2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATL2

Antigène: ATL2 (Atlastin GTPase 2 (ATL2))

Autre désignation: ARL6IP2 (ATL2 Produits)

Synonymes: anticorps ARL3IP2, anticorps ARL6IP2, anticorps atlastin2, anticorps 2010110I21Rik, anticorps AA407293, anticorps AV334690, anticorps Aip-2, anticorps Arl6ip2, anticorps arl6ip2, anticorps ATL2, anticorps fc06e01, anticorps wu:fc06e01, anticorps wu:fv60d03, anticorps atlastin GTPase 2, anticorps atlastin GTPase 2 L homeolog, anticorps ATL2, anticorps Atl2, anticorps atl2.L, anticorps atl2

Sujet: ARL6IP2 is a multi-pass membrane proteinPotential. It belongs to the GBP family. Atlastin GTPases are required for Golgi apparatus and ER morphogenesis.

Poids moléculaire: 66 kDa (MW of target protein)