CCRL2 anticorps
-
- Antigène Voir toutes CCRL2 Anticorps
- CCRL2 (Chemokine (C-C Motif) Receptor-Like 2 (CCRL2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CCRL2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CCRL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNL
- Top Product
- Discover our top product CCRL2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CCRL2 Blocking Peptide, catalog no. 33R-5410, is also available for use as a blocking control in assays to test for specificity of this CCRL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCRL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CCRL2 (Chemokine (C-C Motif) Receptor-Like 2 (CCRL2))
- Autre désignation
- CCRL2 (CCRL2 Produits)
- Synonymes
- anticorps CCRL2, anticorps ACKR5, anticorps CKRX, anticorps CRAM, anticorps CRAM-A, anticorps CRAM-B, anticorps HCR, anticorps 1810047I05Rik, anticorps Ackr5, anticorps CCR11, anticorps Cmkbr1l2, anticorps E01, anticorps L-CCR, anticorps C-C motif chemokine receptor like 2, anticorps chemokine (C-C motif) receptor-like 2, anticorps Ccrl2, anticorps CCRL2
- Sujet
- CCRL2 is a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. CCRL2 gene is expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. The function of this gene is unknown.
- Poids moléculaire
- 39 kDa (MW of target protein)
-