FKBP8 anticorps (C-Term)

N° du produit ABIN634524

Détail du produit anti-FKBP8 anticorps

Antigène: FKBP8 (FK506 Binding Protein 8, 38kDa (FKBP8))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FKBP8 est non-conjugé

Application: Western Blotting (WB)

Specificité: FKBP8 antibody was raised against the C terminal of FKBP8

Purification: Affinity purified

Immunogène: FKBP8 antibody was raised using the C terminal of FKBP8 corresponding to a region with amino acids AIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FKBP8 Blocking Peptide, catalog no. 33R-1277, is also available for use as a blocking control in assays to test for specificity of this FKBP8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FKBP8

Antigène: FKBP8 (FK506 Binding Protein 8, 38kDa (FKBP8))

Autre désignation: FKBP8 (FKBP8 Produits)

Synonymes: anticorps FKBP8, anticorps fkbp8, anticorps 38kDa, anticorps FKBP-38, anticorps FKBP-8, anticorps Fkbp38, anticorps zgc:77672, anticorps FKBP38, anticorps FKBPr38, anticorps FK506 binding protein 8, anticorps FK506 binding protein 8 L homeolog, anticorps FKBP8, anticorps fkbp8, anticorps Fkbp8, anticorps fkbp8.L

Sujet: FKBP8 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. Unlike the other members of the family, it does not seem to have PPIase/rotamase activity. It may have a role in neurons associated with memory function.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: Autophagy