TLR9 anticorps (N-Term)
-
- Antigène Voir toutes TLR9 Anticorps
- TLR9 (Toll-Like Receptor 9 (TLR9))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TLR9 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TLR9 antibody was raised against the N terminal of TLR9
- Purification
- Affinity purified
- Immunogène
- TLR9 antibody was raised using the N terminal of TLR9 corresponding to a region with amino acids VGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
- Top Product
- Discover our top product TLR9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TLR9 Blocking Peptide, catalog no. 33R-9556, is also available for use as a blocking control in assays to test for specificity of this TLR9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TLR9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TLR9 (Toll-Like Receptor 9 (TLR9))
- Autre désignation
- TLR9 (TLR9 Produits)
- Synonymes
- anticorps CD289, anticorps toll like receptor 9, anticorps toll-like receptor 9, anticorps TLR9, anticorps Tlr9
- Sujet
- TLR9 participates in the innate immune response to microbial agents. TLR9 detects the unmethylated cytidine-phosphate-guanosine (CpG) motifs present in bacterial DNA. TLR9 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
- Poids moléculaire
- 113 kDa (MW of target protein)
- Pathways
- Signalisation TLR, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades
-