RHOT1 anticorps (N-Term)

N° du produit ABIN634526

Détail du produit anti-RHOT1 anticorps

Antigène: RHOT1 (Ras Homolog Gene Family, Member T1 (RHOT1))

Épitope: N-Term

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RHOT1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: RHOT1 antibody was raised against the N terminal of RHOT1

Purification: Affinity purified

Immunogène: RHOT1 antibody was raised using the N terminal of RHOT1 corresponding to a region with amino acids MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RHOT1 Blocking Peptide, catalog no. 33R-6147, is also available for use as a blocking control in assays to test for specificity of this RHOT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RHOT1

Antigène: RHOT1 (Ras Homolog Gene Family, Member T1 (RHOT1))

Autre désignation: RHOT1 (RHOT1 Produits)

Synonymes: anticorps rhot1, anticorps zgc:55581, anticorps zgc:77063, anticorps wu:fd14e11, anticorps wu:fi14a05, anticorps arht2, anticorps miro-2, anticorps rasl, anticorps ARHT1, anticorps MIRO-1, anticorps MIRO1, anticorps 2210403N23Rik, anticorps AA415293, anticorps AF244542, anticorps AI834919, anticorps Arht1, anticorps C430039G08Rik, anticorps Miro1, anticorps miro1, anticorps si:dkeyp-97g3.6, anticorps ras homolog family member T1a, anticorps ras homolog family member T2, anticorps ras homolog family member T1, anticorps ras homolog family member T1 L homeolog, anticorps rhot1a, anticorps rhot2, anticorps RHOT1, anticorps rhot1, anticorps rhot1.L, anticorps Rhot1, anticorps rhot1b

Sujet: Mitochondrial GTPase involved in mitochondrial trafficking. RHOT1 is probably involved in control of anterograde transport of mitochondria and their subcellular distribution.

Poids moléculaire: 71 kDa (MW of target protein)