ADCY6 anticorps (C-Term)

N° du produit ABIN634528

Détail du produit anti-ADCY6 anticorps

Antigène: ADCY6 (Adenylate Cyclase 6 (ADCY6))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADCY6 est non-conjugé

Application: Western Blotting (WB)

Specificité: ADCY6 antibody was raised against the C terminal of ADCY6

Purification: Affinity purified

Immunogène: ADCY6 antibody was raised using the C terminal of ADCY6 corresponding to a region with amino acids LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADCY6 Blocking Peptide, catalog no. 33R-5069, is also available for use as a blocking control in assays to test for specificity of this ADCY6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADCY6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADCY6

Antigène: ADCY6 (Adenylate Cyclase 6 (ADCY6))

Autre désignation: ADCY6 (ADCY6 Produits)

Synonymes: anticorps ADCY6, anticorps adcy6, anticorps AC6, anticorps mKIAA0422, anticorps ACVI, anticorps ADCYB, anticorps adenylate cyclase 6 L homeolog, anticorps adenylate cyclase 6, anticorps adenylate cyclase 6a, anticorps adcy6.L, anticorps ADCY6, anticorps adcy6a, anticorps adcy6, anticorps Adcy6

Sujet: ADCY6 is adenylate cyclase 6, which is a membrane-associated enzyme and catalyzes the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). The expression of ADCY6 is found in normal thyroid and brain tissues, as well as some tumors, and its expression is significantly higher in one hyperfunctioning thyroid tumor than in normal thyroid tissue.

Poids moléculaire: 125 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma