ADCY8 anticorps

N° du produit ABIN634530

Détail du produit anti-ADCY8 anticorps

Antigène: ADCY8 (Adenylate Cyclase 8 (Brain) (ADCY8))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADCY8 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ADCY8 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADCY8 Blocking Peptide, catalog no. 33R-2494, is also available for use as a blocking control in assays to test for specificity of this ADCY8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADCY8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADCY8

Antigène: ADCY8 (Adenylate Cyclase 8 (Brain) (ADCY8))

Autre désignation: ADCY8 (ADCY8 Produits)

Synonymes: anticorps MGC121231, anticorps si:ch211-220f13.4, anticorps AC8, anticorps AW060868, anticorps ADCY3, anticorps HBAC1, anticorps Ac8, anticorps adenylate cyclase 8 (brain) S homeolog, anticorps adenylate cyclase 8, anticorps adenylate cyclase 8 (brain), anticorps adenylate cyclase type 8, anticorps adenylate cyclase 3, anticorps adcy8.S, anticorps ADCY8, anticorps adcy8, anticorps LOC100461383, anticorps Adcy8, anticorps ADCY3

Sujet: Adenylate cyclase is a membrane bound enzyme that catalyses the formation of cyclic AMP from ATP. The enzymatic activity is under the control of several hormones, and different polypeptides participate in the transduction of the signal from the receptor to the catalytic moiety. Stimulatory or inhibitory receptors (Rs and Ri) interact with G proteins (Gs and Gi) that exhibit GTPase activity and they modulate the activity of the catalytic subunit of the adenylyl cyclase.

Poids moléculaire: 140 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma