TAP1 anticorps

N° du produit ABIN634533

Détail du produit anti-TAP1 anticorps

Antigène: TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TAP1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TAP1 Blocking Peptide, catalog no. 33R-5544, is also available for use as a blocking control in assays to test for specificity of this TAP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TAP1

Antigène: TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))

Autre désignation: TAP1 (TAP1 Produits)

Synonymes: anticorps ABC17, anticorps ABCB2, anticorps APT1, anticorps D6S114E, anticorps PSF-1, anticorps PSF1, anticorps RING4, anticorps TAP1*0102N, anticorps TAP1N, anticorps abc17, anticorps abcb2, anticorps apt1, anticorps psf1, anticorps ring4, anticorps tap1a, anticorps tap1n, anticorps Abcb2, anticorps Ham-1, anticorps Ham1, anticorps MTP1, anticorps TAP, anticorps Tap-1, anticorps Y3, anticorps Cim, anticorps transporter 1, ATP binding cassette subfamily B member, anticorps transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) L homeolog, anticorps transporter 1, ATP-binding cassette, sub-family B (MDR/TAP), anticorps TAP1, anticorps tap1.L, anticorps Tap1

Sujet: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White).

Poids moléculaire: 87 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Human Leukocyte Antigen (HLA) in Adaptive Immune Response