BAFF anticorps
-
- Antigène Voir toutes BAFF (TNFSF13B) Anticorps
- BAFF (TNFSF13B) (Tumor Necrosis Factor (Ligand) Superfamily, Member 13b (TNFSF13B))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp BAFF est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- TNFSF13 B antibody was raised using a synthetic peptide corresponding to a region with amino acids ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP
- Top Product
- Discover our top product TNFSF13B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TNFSF13B Blocking Peptide, catalog no. 33R-1363, is also available for use as a blocking control in assays to test for specificity of this TNFSF13B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNFSF10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- BAFF (TNFSF13B) (Tumor Necrosis Factor (Ligand) Superfamily, Member 13b (TNFSF13B))
- Autre désignation
- TNFSF13B (TNFSF13B Produits)
- Synonymes
- anticorps BAFF, anticorps BLYS, anticorps CD257, anticorps DTL, anticorps TALL-1, anticorps TALL1, anticorps THANK, anticorps TNFSF20, anticorps ZTNF4, anticorps BAFF-R, anticorps BAFFR, anticorps BROMIX, anticorps CD268, anticorps CVID4, anticorps prolixin, anticorps TNFSF13B, anticorps RGD1561519, anticorps RGD1560810, anticorps BLyS, anticorps D8Ertd387e, anticorps zTNF4, anticorps 2010006P15Rik, anticorps Baffr, anticorps Bcmd, anticorps Bcmd-1, anticorps Bcmd1, anticorps Lvis22, anticorps zgc:172115, anticorps TNF superfamily member 13b, anticorps TNF receptor superfamily member 13C, anticorps tumor necrosis factor (ligand) superfamily, member 13b, anticorps tumor necrosis factor receptor superfamily, member 13c, anticorps tumor necrosis factor superfamily member 13b, anticorps TNFSF13B, anticorps TNFRSF13C, anticorps Tnfsf13b, anticorps Tnfrsf13c, anticorps tnfsf13b
- Sujet
- The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR.
- Poids moléculaire
- 31 kDa (MW of target protein)
- Pathways
- Signalisation NF-kappaB, Production of Molecular Mediator of Immune Response
-