ADCY10 anticorps (N-Term)

N° du produit ABIN634544

Détail du produit anti-ADCY10 anticorps

Antigène: ADCY10 (Adenylate Cyclase 10 (Soluble) (ADCY10))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADCY10 est non-conjugé

Application: Western Blotting (WB)

Specificité: SAC antibody was raised against the N terminal Of Sac

Purification: Affinity purified

Immunogène: SAC antibody was raised using the N terminal Of Sac corresponding to a region with amino acids VGHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SAC Blocking Peptide, catalog no. 33R-9558, is also available for use as a blocking control in assays to test for specificity of this SAC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADCY10

Antigène: ADCY10 (Adenylate Cyclase 10 (Soluble) (ADCY10))

Autre désignation: SAC (ADCY10 Produits)

Synonymes: anticorps HCA2, anticorps RP1-313L4.2, anticorps SAC, anticorps SACI, anticorps Sacy, anticorps Sac, anticorps 4930431D04Rik, anticorps 4931412F17, anticorps sAC, anticorps ADCY10, anticorps SACY, anticorps adenylate cyclase 10, anticorps adenylate cyclase 10 (soluble), anticorps ADCY10, anticorps Adcy10

Sujet: SAC belongs to a distinct class of mammalian adenylyl cyclase that is soluble and insensitive to G protein or forskolin regulation. It is localized in the cytoplasm and is thought to function as a general bicarbonate sensor throughout the body. It may also play an important role in the generation of cAMP in spermatozoa, implying possible roles in sperm maturation through the epididymis, capacitation, hypermotility, and/or the acrosome reaction.

Poids moléculaire: 187 kDa (MW of target protein)

Pathways: cAMP Metabolic Process