UQCRFS1 anticorps (N-Term)

N° du produit ABIN634545

Détail du produit anti-UQCRFS1 anticorps

Antigène: UQCRFS1 (Ubiquinol-Cytochrome C Reductase, Rieske Iron-Sulfur Polypeptide 1 (UQCRFS1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UQCRFS1 est non-conjugé

Application: Western Blotting (WB)

Specificité: UQCRFS1 antibody was raised against the N terminal of UQCRFS1

Purification: Affinity purified

Immunogène: UQCRFS1 antibody was raised using the N terminal of UQCRFS1 corresponding to a region with amino acids MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UQCRFS1 Blocking Peptide, catalog no. 33R-6220, is also available for use as a blocking control in assays to test for specificity of this UQCRFS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UQCRFS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UQCRFS1

Antigène: UQCRFS1 (Ubiquinol-Cytochrome C Reductase, Rieske Iron-Sulfur Polypeptide 1 (UQCRFS1))

Autre désignation: UQCRFS1 (UQCRFS1 Produits)

Synonymes: anticorps uqcrfs1, anticorps MGC53134, anticorps rip1, anticorps ris1, anticorps risp, anticorps uqcr5, anticorps fb78f10, anticorps wu:fb05d11, anticorps wu:fb78f10, anticorps wu:fj05e12, anticorps zgc:73109, anticorps zgc:85614, anticorps GLEAN_00043, anticorps RIP1, anticorps RIS1, anticorps RISP, anticorps UQCR5, anticorps 4430402G14Rik, anticorps AI875505, anticorps LRRGT00195, anticorps UQCRFSL1, anticorps ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 S homeolog, anticorps ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1, anticorps cytochrome b-c1 complex subunit Rieske, mitochondrial, anticorps iron-sulfur protein 1, anticorps uqcrfs1.S, anticorps uqcrfs1, anticorps LOC661125, anticorps LOC705178, anticorps UQCRFS1, anticorps Uqcrfs1, anticorps LOC100227575, anticorps isp1

Sujet: UQCRFS1 is the component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.

Poids moléculaire: 30 kDa (MW of target protein)

Pathways: Proton Transport