Selenoprotein S anticorps (Middle Region)
-
- Antigène Voir toutes Selenoprotein S (SELS) Anticorps
- Selenoprotein S (SELS)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Selenoprotein S est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SELS antibody was raised against the middle region of SELS
- Purification
- Affinity purified
- Immunogène
- SELS antibody was raised using the middle region of SELS corresponding to a region with amino acids PDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDS
- Top Product
- Discover our top product SELS Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SELS Blocking Peptide, catalog no. 33R-7030, is also available for use as a blocking control in assays to test for specificity of this SELS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SELS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Selenoprotein S (SELS)
- Autre désignation
- SELS (SELS Produits)
- Synonymes
- anticorps ADO15, anticorps SBBI8, anticorps SELS, anticorps SEPS1, anticorps 1500011E07Rik, anticorps C78786, anticorps H-4, anticorps H-47, anticorps H4, anticorps H47, anticorps Sels, anticorps sg2, anticorps selenoprotein S, anticorps SELENOS, anticorps Selenos
- Sujet
- SELS is a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Studies suggest that this protein may regulate cytokine production, and thus play a key role in the control of the inflammatory response.
- Poids moléculaire
- 21 kDa (MW of target protein)
- Pathways
- Cellular Response to Molecule of Bacterial Origin, ER-Nucleus Signaling, Regulation of Carbohydrate Metabolic Process, Cell RedoxHomeostasis, Negative Regulation of intrinsic apoptotic Signaling, SARS-CoV-2 Protein Interactome
-