ADAM33 anticorps (Middle Region)
-
- Antigène Voir toutes ADAM33 Anticorps
- ADAM33 (ADAM Metallopeptidase Domain 33 (ADAM33))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ADAM33 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ADAM33 antibody was raised against the middle region of ADAM33
- Purification
- Affinity purified
- Immunogène
- ADAM33 antibody was raised using the middle region of ADAM33 corresponding to a region with amino acids HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA
- Top Product
- Discover our top product ADAM33 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ADAM33 Blocking Peptide, catalog no. 33R-3711, is also available for use as a blocking control in assays to test for specificity of this ADAM33 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM33 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ADAM33 (ADAM Metallopeptidase Domain 33 (ADAM33))
- Autre désignation
- ADAM33 (ADAM33 Produits)
- Sujet
- ADAM33 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM33 is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness.
- Poids moléculaire
- 62 kDa (MW of target protein)
-