Tetraspanin 6 anticorps (N-Term)

N° du produit ABIN634550

Détail du produit anti-Tetraspanin 6 anticorps

Antigène: Tetraspanin 6 (TSPAN6)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Tetraspanin 6 est non-conjugé

Application: Western Blotting (WB)

Specificité: Tetraspanin 6 antibody was raised against the N terminal of TSPAN6

Purification: Affinity purified

Immunogène: Tetraspanin 6 antibody was raised using the N terminal of TSPAN6 corresponding to a region with amino acids VGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFGCFATCRASA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tetraspanin 6 Blocking Peptide, catalog no. 33R-9562, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Tetraspanin 6

Antigène: Tetraspanin 6 (TSPAN6)

Autre désignation: Tetraspanin 6 (TSPAN6 Produits)

Synonymes: anticorps GB14865, anticorps TSPAN6, anticorps t245, anticorps tm4sf6, anticorps tspan-6, anticorps DKFZp469J2433, anticorps TM4SF6, anticorps T245, anticorps TSPAN-6, anticorps 6720473L21Rik, anticorps AI316786, anticorps Tm4sf, anticorps Tm4sf6, anticorps tetraspanin 6, anticorps TSPAN6, anticorps Tspan6, anticorps tspan6

Sujet: TSPAN6 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein and is highly similar in sequence to the transmembrane 4 superfamily member 2.

Poids moléculaire: 27 kDa (MW of target protein)