TLR5 anticorps (N-Term)
-
- Antigène Voir toutes TLR5 Anticorps
- TLR5 (Toll-Like Receptor 5 (TLR5))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TLR5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TLR5 antibody was raised against the N terminal of TLR5
- Purification
- Affinity purified
- Immunogène
- TLR5 antibody was raised using the N terminal of TLR5 corresponding to a region with amino acids QLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFH
- Top Product
- Discover our top product TLR5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TLR5 Blocking Peptide, catalog no. 33R-7642, is also available for use as a blocking control in assays to test for specificity of this TLR5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TLR5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TLR5 (Toll-Like Receptor 5 (TLR5))
- Autre désignation
- TLR5 (TLR5 Produits)
- Synonymes
- anticorps SLEB1, anticorps TIL3, anticorps TLR-5, anticorps sleb1, anticorps til3, anticorps tlr-5, anticorps tlr5, anticorps toll like receptor 5, anticorps toll-like receptor 5, anticorps toll like receptor 5 L homeolog, anticorps toll-like receptor 5b, anticorps TLR5, anticorps Tlr5, anticorps tlr5.L, anticorps tlr-5, anticorps tlr5b
- Sujet
- TLR5 participates in the innate immune response to microbial agents. It mediates detection of bacterial flagellins. TLR5 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
- Poids moléculaire
- 98 kDa (MW of target protein)
- Pathways
- Signalisation TLR, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades
-