ULBP1 anticorps (N-Term)

N° du produit ABIN634554

Détail du produit anti-ULBP1 anticorps

Antigène: ULBP1 (UL16 Binding Protein 1 (ULBP1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ULBP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ULBP1 antibody was raised against the N terminal of ULBP1

Purification: Affinity purified

Immunogène: ULBP1 antibody was raised using the N terminal of ULBP1 corresponding to a region with amino acids MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ULBP1 Blocking Peptide, catalog no. 33R-5583, is also available for use as a blocking control in assays to test for specificity of this ULBP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ULBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ULBP1

Antigène: ULBP1 (UL16 Binding Protein 1 (ULBP1))

Autre désignation: ULBP1 (ULBP1 Produits)

Synonymes: anticorps RAET1I, anticorps A430108B07Rik, anticorps MULT1, anticorps ULBP1, anticorps UL16 binding protein 1, anticorps UL16 binding protein 21, anticorps NKG2D ligand 1, anticorps ULBP1, anticorps ULBP21, anticorps Ulbp1, anticorps LOC100683099

Sujet: ULBP1 is the ligand for the NKG2D receptor, together with at least ULBP2 and ULBP3. ULBPs activate multiple signaling pathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway. In CMV infected cells, interacts with soluble CMV glycoprotein UL16. The interaction with UL16 blocked the interaction with the NKG2D receptor, providing a mechanism by which CMV infected cells might escape the immune system. UL16 also causes ULBP1 to be retained in the ER and cis-Golgi apparatus so that it does not reach the cell surface.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process