HFE anticorps (N-Term)

N° du produit ABIN634556

Détail du produit anti-HFE anticorps

Antigène: HFE (Hemochromatosis (HFE))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HFE est non-conjugé

Application: Western Blotting (WB)

Specificité: HFE antibody was raised against the N terminal of HFE

Purification: Affinity purified

Immunogène: HFE antibody was raised using the N terminal of HFE corresponding to a region with amino acids MGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HFE Blocking Peptide, catalog no. 33R-6012, is also available for use as a blocking control in assays to test for specificity of this HFE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HFE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HFE

Antigène: HFE (Hemochromatosis (HFE))

Autre désignation: HFE (HFE Produits)

Synonymes: anticorps HFE1, anticorps HH, anticorps HLA-H, anticorps MVCD7, anticorps TFQTL2, anticorps MR2, anticorps hemochromatosis, anticorps HFE, anticorps Hfe

Sujet: HFE is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in its gene.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process