SLC20A1 anticorps
-
- Antigène Voir toutes SLC20A1 Anticorps
- SLC20A1 (Solute Carrier Family 20 (Phosphate Transporter), Member 1 (SLC20A1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC20A1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC20 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDL
- Top Product
- Discover our top product SLC20A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC20A1 Blocking Peptide, catalog no. 33R-5497, is also available for use as a blocking control in assays to test for specificity of this SLC20A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC20A1 (Solute Carrier Family 20 (Phosphate Transporter), Member 1 (SLC20A1))
- Autre désignation
- SLC20A1 (SLC20A1 Produits)
- Synonymes
- anticorps SLC20A1, anticorps DKFZp459N1424, anticorps Glvr-1, anticorps pit1, anticorps slc20a1, anticorps xSLC20A1, anticorps GLVR1, anticorps PIT1, anticorps PiT-1, anticorps AI607883, anticorps Glvr1, anticorps solute carrier family 20 member 1, anticorps solute carrier family 20 member 1 L homeolog, anticorps solute carrier family 20, member 1, anticorps SLC20A1, anticorps slc20a1.L, anticorps Slc20a1
- Sujet
- Retrovirus receptors allow infection of human and murine cells by various retroviruses. The receptors that have been identified at the molecular level include CD4 for human immunodeficiency virus, Rec1 for murine ecotropic virus, and GLVR1 for gibbon ape leukemia virus. These 3 proteins show no homology to one another at the DNA or protein level. GLVR1 is a sodium-dependent phosphate symporter.
- Poids moléculaire
- 74 kDa (MW of target protein)
-