C1QB anticorps (Middle Region)
-
- Antigène Voir toutes C1QB Anticorps
- C1QB (Complement Component 1, Q Subcomponent, B Chain (C1QB))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C1QB est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C1 QB antibody was raised against the middle region of C1 B
- Purification
- Affinity purified
- Immunogène
- C1 QB antibody was raised using the middle region of C1 B corresponding to a region with amino acids PGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPR
- Top Product
- Discover our top product C1QB Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C1QB Blocking Peptide, catalog no. 33R-7122, is also available for use as a blocking control in assays to test for specificity of this C1QB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 B antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C1QB (Complement Component 1, Q Subcomponent, B Chain (C1QB))
- Autre désignation
- C1QB (C1QB Produits)
- Synonymes
- anticorps complement C1q B chain, anticorps complement component 1, q subcomponent, beta polypeptide, anticorps C1QB, anticorps C1qb
- Sujet
- C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
- Poids moléculaire
- 27 kDa (MW of target protein)
- Pathways
- Système du Complément
-