EPOR anticorps (N-Term)

N° du produit ABIN634567

Détail du produit anti-EPOR anticorps

Antigène: EPOR (Erythropoietin Receptor (EPOR))

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EPOR est non-conjugé

Application: Western Blotting (WB)

Specificité: EPOr antibody was raised against the N terminal of EPOR

Purification: Affinity purified

Immunogène: EPOr antibody was raised using the N terminal of EPOR corresponding to a region with amino acids DHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EPOr Blocking Peptide, catalog no. 33R-1978, is also available for use as a blocking control in assays to test for specificity of this EPOr antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPOR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EPOR

Antigène: EPOR (Erythropoietin Receptor (EPOR))

Autre désignation: EPOr (EPOR Produits)

Synonymes: anticorps EPOR, anticorps epor, anticorps EPO-R, anticorps erythropoietin receptor, anticorps erythropoietin receptor L homeolog, anticorps EPOR, anticorps epor, anticorps Epor, anticorps epor.L

Sujet: The erythropoietin receptor is a member of the cytokine receptor family. Upon erythropoietin binding, the erythropoietin receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT