ASB5 anticorps (C-Term)

N° du produit ABIN634568

Détail du produit anti-ASB5 anticorps

Antigène: ASB5 (Ankyrin Repeat and SOCS Box Containing 5 (ASB5))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ASB5 est non-conjugé

Application: Western Blotting (WB)

Specificité: ASB5 antibody was raised against the C terminal of ASB5

Purification: Affinity purified

Immunogène: ASB5 antibody was raised using the C terminal of ASB5 corresponding to a region with amino acids LLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ASB5 Blocking Peptide, catalog no. 33R-5157, is also available for use as a blocking control in assays to test for specificity of this ASB5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ASB5

Antigène: ASB5 (Ankyrin Repeat and SOCS Box Containing 5 (ASB5))

Autre désignation: ASB5 (ASB5 Produits)

Synonymes: anticorps ASB-5, anticorps 1110018D09Rik, anticorps ankyrin repeat and SOCS box containing 5, anticorps ankyrin repeat and SOCs box-containing 5, anticorps ankyrin repeat and SOCS box-containing 5, anticorps ASB5, anticorps Asb5

Sujet: They contain ankyrin repeat sequence and SOCS box domain. The SOCSbox serves to couple suppressor of cytokine signalling (SOCS)proteins and their binding partners with the elongin B and Ccomplex, possibly targeting them for degradation.

Poids moléculaire: 36 kDa (MW of target protein)