DGKE anticorps (N-Term)

N° du produit ABIN634569

Détail du produit anti-DGKE anticorps

Antigène: DGKE (Diacylglycerol Kinase, epsilon 64kDa (DGKE))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DGKE est non-conjugé

Application: Western Blotting (WB)

Specificité: DGKE antibody was raised against the N terminal of DGKE

Purification: Affinity purified

Immunogène: DGKE antibody was raised using the N terminal of DGKE corresponding to a region with amino acids EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DGKE Blocking Peptide, catalog no. 33R-2256, is also available for use as a blocking control in assays to test for specificity of this DGKE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGKE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DGKE

Antigène: DGKE (Diacylglycerol Kinase, epsilon 64kDa (DGKE))

Autre désignation: DGKE (DGKE Produits)

Synonymes: anticorps MGC81643, anticorps DGKE, anticorps C87606, anticorps DAGK6, anticorps DGK, anticorps DAGK5, anticorps NPHS7, anticorps diacylglycerol kinase epsilon S homeolog, anticorps diacylglycerol kinase epsilon, anticorps diacylglycerol kinase, epsilon, anticorps dgke.S, anticorps DGKE, anticorps dgke, anticorps LOC5575244, anticorps Dgke

Sujet: Diacylglycerol kinases are thought to be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction. When expressed in mammalian cells, DGK-epsilon shows specificity for arachidonyl-containing diacylglycerol. DGK-epsilon is expressed predominantly in testis.

Poids moléculaire: 64 kDa (MW of target protein)