IL-22 anticorps (C-Term)

N° du produit ABIN634575

Détail du produit anti-IL-22 anticorps

Antigène: IL-22 (IL22) (Interleukin 22 (IL22))

Épitope: C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IL-22 est non-conjugé

Application: Western Blotting (WB)

Specificité: IL22 antibody was raised against the C terminal of IL22

Purification: Affinity purified

Immunogène: IL22 antibody was raised using the C terminal of IL22 corresponding to a region with amino acids CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IL22 Blocking Peptide, catalog no. 33R-1709, is also available for use as a blocking control in assays to test for specificity of this IL22 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IL-22

Antigène: IL-22 (IL22) (Interleukin 22 (IL22))

Autre désignation: IL22 (IL22 Produits)

Sujet: IL22 belongs to the IL-10 family. It is a cytokine that contributes to the inflammatory response in vivo.

Poids moléculaire: 20 kDa (MW of target protein)