CALCRL anticorps (N-Term)
-
- Antigène Voir toutes CALCRL Anticorps
- CALCRL (Calcitonin Receptor-Like (CALCRL))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CALCRL est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CALCRL antibody was raised against the N terminal of CALCRL
- Purification
- Affinity purified
- Immunogène
- CALCRL antibody was raised using the N terminal of CALCRL corresponding to a region with amino acids DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL
- Top Product
- Discover our top product CALCRL Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CALCRL Blocking Peptide, catalog no. 33R-1962, is also available for use as a blocking control in assays to test for specificity of this CALCRL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CALCRL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CALCRL (Calcitonin Receptor-Like (CALCRL))
- Autre désignation
- CALCRL (CALCRL Produits)
- Synonymes
- anticorps CALCRL, anticorps CGRPR, anticorps CRLR, anticorps AV071593, anticorps CLR, anticorps Crlr, anticorps RATCRLR, anticorps RNCLR, anticorps calcitonin receptor like receptor, anticorps calcitonin receptor-like, anticorps calcitonin receptor like receptor L homeolog, anticorps CALCRL, anticorps LOC100168906, anticorps calcrl, anticorps Calcrl, anticorps calcrl.L
- Sujet
- CALCRL is the receptor for calcitonin-gene-related peptide (CGRP) together with RAMP1 and receptor for adrenomedullin together with RAMP2 or RAMP3. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
- Poids moléculaire
- 53 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process
-