GHRHR anticorps (N-Term)

N° du produit ABIN634579

Détail du produit anti-GHRHR anticorps

Antigène: GHRHR (Growth Hormone Releasing Hormone Receptor (GHRHR))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GHRHR est non-conjugé

Application: Western Blotting (WB)

Specificité: GHRHR antibody was raised against the N terminal of GHRHR

Purification: Affinity purified

Immunogène: GHRHR antibody was raised using the N terminal of GHRHR corresponding to a region with amino acids VTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GHRHR Blocking Peptide, catalog no. 33R-9852, is also available for use as a blocking control in assays to test for specificity of this GHRHR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GHRHR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GHRHR

Antigène: GHRHR (Growth Hormone Releasing Hormone Receptor (GHRHR))

Autre désignation: GHRHR (GHRHR Produits)

Synonymes: anticorps GHRFR, anticorps GRFR, anticorps IGHD1B, anticorps Ghrfr, anticorps lit, anticorps little, anticorps GHRHREC, anticorps GHRH-R, anticorps growth hormone releasing hormone receptor, anticorps GHRHR, anticorps Ghrhr

Sujet: GHRHR is a receptor for growth hormone-releasing hormone. Binding of this hormone to the receptor leads to synthesis and release of growth hormone. Mutations in its gene have been associated with isolated growth hormone deficiency (IGHD), also known as Dwarfism of Sindh, a disorder characterized by short stature.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Hormone Transport, Regulation of Intracellular Steroid Hormone Receptor Signaling, cAMP Metabolic Process