SERPINB2 anticorps

N° du produit ABIN634589

Détail du produit anti-SERPINB2 anticorps

Antigène: SERPINB2 (Plasminogen Activator Inhibitor 2 (SERPINB2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SERPINB2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SERPINB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SERPINB2 Blocking Peptide, catalog no. 33R-3366, is also available for use as a blocking control in assays to test for specificity of this SERPINB2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SERPINB2

Antigène: SERPINB2 (Plasminogen Activator Inhibitor 2 (SERPINB2))

Autre désignation: SERPINB2 (SERPINB2 Produits)

Synonymes: anticorps HsT1201, anticorps PAI, anticorps PAI-2, anticorps PAI2, anticorps PLANH2, anticorps SERPINB2, anticorps Planh2, anticorps ovalbumin, anticorps Pai2a, anticorps serpin family B member 2, anticorps serpin peptidase inhibitor, clade B (ovalbumin), member 2, anticorps serine (or cysteine) peptidase inhibitor, clade B, member 2, anticorps SERPINB2, anticorps Serpinb2

Classe de substances: Amino Acid

Sujet: SERPINB2 inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: Autophagy