PPP1R13B anticorps

N° du produit ABIN634596

Détail du produit anti-PPP1R13B anticorps

Antigène: PPP1R13B (Protein Phosphatase 1, Regulatory Subunit 13B (PPP1R13B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPP1R13B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PPP1 R11 antibody was raised using a synthetic peptide corresponding to a region with amino acids EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPP1R13B Blocking Peptide, catalog no. 33R-2400, is also available for use as a blocking control in assays to test for specificity of this PPP1R13B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPP1R13B

Antigène: PPP1R13B (Protein Phosphatase 1, Regulatory Subunit 13B (PPP1R13B))

Autre désignation: PPP1R13B (PPP1R13B Produits)

Synonymes: anticorps ASPP1, anticorps p53BP2-like, anticorps p85, anticorps AI449786, anticorps AW545810, anticorps Tp53bp2, anticorps Trp53bp2, anticorps protein phosphatase 1 regulatory subunit 13B, anticorps protein phosphatase 1, regulatory subunit 13B, anticorps protein phosphatase 1 regulatory subunit 13B L homeolog, anticorps protein phosphatase 1, regulatory subunit 13Bb, anticorps protein phosphatase 1, regulatory (inhibitor) subunit 13B, anticorps PPP1R13B, anticorps Ppp1r13b, anticorps ppp1r13b.L, anticorps ppp1r13bb, anticorps ppp1r13b

Sujet: PPP1R13B is a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. ASPP proteins are required for the induction of apoptosis by p53-family proteins. They promote DNA binding and transactivation of p53-family proteins on the promoters of proapoptotic genes. Expression of this gene is regulated by the E2F transcription factor.

Poids moléculaire: 119 kDa (MW of target protein)

Pathways: Signalisation p53