ELMOD2 anticorps (N-Term)

N° du produit ABIN634597

Détail du produit anti-ELMOD2 anticorps

Antigène: ELMOD2 (ELMO/CED-12 Domain Containing 2 (ELMOD2))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ELMOD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: ELMOD2 antibody was raised against the N terminal of ELMOD2

Purification: Affinity purified

Immunogène: ELMOD2 antibody was raised using the N terminal of ELMOD2 corresponding to a region with amino acids FDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNIN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ELMOD2 Blocking Peptide, catalog no. 33R-2873, is also available for use as a blocking control in assays to test for specificity of this ELMOD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELMOD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ELMOD2

Antigène: ELMOD2 (ELMO/CED-12 Domain Containing 2 (ELMOD2))

Autre désignation: ELMOD2 (ELMOD2 Produits)

Synonymes: anticorps ELMOD2, anticorps 9830169G11Rik, anticorps ELMO domain containing 2, anticorps ELMO/CED-12 domain containing 2, anticorps ELMOD2, anticorps Elmod2

Sujet: ELMOD2 is an engulfment and motility (ELMO) domain-containing protein.

Poids moléculaire: 35 kDa (MW of target protein)