Symplekin anticorps (N-Term)

N° du produit ABIN634602

Détail du produit anti-Symplekin anticorps

Antigène: Symplekin (SYMPK)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Symplekin est non-conjugé

Application: Western Blotting (WB)

Specificité: Symplekin antibody was raised against the N terminal of SYMPK

Purification: Affinity purified

Immunogène: Symplekin antibody was raised using the N terminal of SYMPK corresponding to a region with amino acids RTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Symplekin Blocking Peptide, catalog no. 33R-8224, is also available for use as a blocking control in assays to test for specificity of this Symplekin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYMPK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Symplekin

Antigène: Symplekin (SYMPK)

Autre désignation: Symplekin (SYMPK Produits)

Synonymes: anticorps SPK, anticorps SYM, anticorps CG2097, anticorps Dmel\\CG2097, anticorps dSymp, anticorps 1500016F02Rik, anticorps 4632415H16Rik, anticorps AA125406, anticorps AI449890, anticorps Hfn3g, anticorps sympk, anticorps MGC75595, anticorps SYMPK, anticorps T22C5.3, anticorps DKFZp468C0711, anticorps symplekin, anticorps Symplekin, anticorps symplekin S homeolog, anticorps SYMPK, anticorps Sym, anticorps Sympk, anticorps sympk.S, anticorps sympk, anticorps LOC552752, anticorps AT1G27595, anticorps LOC5580150, anticorps CpipJ_CPIJ011126, anticorps Bm1_50390, anticorps NAEGRDRAFT_80124, anticorps LOAG_00841

Sujet: SYMPK is a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex.

Poids moléculaire: 141 kDa (MW of target protein)