Claudin 16 anticorps (C-Term)
-
- Antigène Voir toutes Claudin 16 (CLDN16) Anticorps
- Claudin 16 (CLDN16)
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Claudin 16 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Claudin 16 antibody was raised against the C terminal of CLDN16
- Purification
- Affinity purified
- Immunogène
- Claudin 16 antibody was raised using the C terminal of CLDN16 corresponding to a region with amino acids FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA
- Top Product
- Discover our top product CLDN16 Anticorps primaire
-
anti-Claudin 16 (CLDN16) (AA 6-33), (N-Term) antibody
CLDN16 Reactivité: Humain WB, FACS, IHC (p) Hôte: Lapin Polyclonal RB30098 unconjugated
anti-Claudin 16 (CLDN16) (AA 1-73) antibodyCLDN16 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 1F2 unconjugated
anti-Claudin 16 (CLDN16) (AA 1-73) antibodyCLDN16 Reactivité: Humain WB, ELISA Hôte: Souris Polyclonal unconjugated
anti-Claudin 16 (CLDN16) (AA 13-41), (N-Term) antibodyCLDN16 Reactivité: Humain WB, FACS, IHC (p), EIA Hôte: Lapin Polyclonal unconjugated
anti-Claudin 16 (CLDN16) (AA 50-150) antibodyCLDN16 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Claudin 16 (CLDN16) (C-Term) antibodyCLDN16 Reactivité: Humain, Souris, Porc, Boeuf (Vache), Chien, Singe WB Hôte: Lapin Polyclonal unconjugated
anti-Claudin 16 (CLDN16) (AA 6-33) antibodyCLDN16 Reactivité: Humain WB, FACS, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Claudin 16 (CLDN16) (C-Term) antibodyCLDN16 Reactivité: Humain, Souris, Porc, Rat, Boeuf (Vache), Chien, Lapin, Cheval WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Claudin 16 (CLDN16)
- Autre désignation
- Claudin 16 (CLDN16 Produits)
- Synonymes
- anticorps CLDN16, anticorps HOMG3, anticorps PCLN1, anticorps claudin-16, anticorps Pcln1, anticorps claudin 16, anticorps CLDN16, anticorps Cldn16
- Sujet
- Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. Claudin-16, a member of the claudin family, is an integral membrane protein and a component of tight junction strands.
- Poids moléculaire
- 34 kDa (MW of target protein)
- Pathways
- Hepatitis C
-
