Annexin a10 anticorps (Middle Region)

N° du produit ABIN634610

Détail du produit anti-Annexin a10 anticorps

Antigène: Annexin a10 (ANXA10) (Annexin A10 (ANXA10))

Épitope: Middle Region

Reactivité: Chemical

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Annexin a10 est non-conjugé

Application: Western Blotting (WB)

Specificité: Annexin A10 antibody was raised against the middle region of ANXA10

Réactivité croisée: Humain

Purification: Affinity purified

Immunogène: Annexin A10 antibody was raised using the middle region of ANXA10 corresponding to a region with amino acids VLWEACQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Annexin A10 Blocking Peptide, catalog no. 33R-9693, is also available for use as a blocking control in assays to test for specificity of this Annexin A10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Annexin a10

Antigène: Annexin a10 (ANXA10) (Annexin A10 (ANXA10))

Autre désignation: Annexin A10 (ANXA10 Produits)

Synonymes: anticorps ANXA10, anticorps ANX14, anticorps RGD1560956, anticorps annexin A10, anticorps ANXA10, anticorps anxa10, anticorps Anxa10

Classe de substances: Chemical

Sujet: This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The function of this gene has not yet been dete

Poids moléculaire: 37 kDa (MW of target protein)