-
- Antigène Voir toutes Ig Anticorps
- Ig
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Ig est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ARHGDIG antibody was raised using a synthetic peptide corresponding to a region with amino acids DEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPN
- Top Product
- Discover our top product Ig Anticorps primaire
-
anti-Ig antibody (PE)
Reactivité: Lapin ELISA, FACS, FLISA Hôte: Rat Monoclonal SB87a PE
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ARHGDIG Blocking Peptide, catalog no. 33R-1892, is also available for use as a blocking control in assays to test for specificity of this ARHGDIG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGDIG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Ig
- Abstract
- Ig Produits
- Synonymes
- anticorps ATPIG, anticorps ATPIQ, anticorps A330005H02Rik, anticorps AI315324, anticorps Ig, anticorps ATPase phospholipid transporting 11C, anticorps ATPase, class VI, type 11C, anticorps ATP11C, anticorps Atp11c
- Sujet
- ARHGDIG is highly expressed in the entire brain, with regional variations. The mRNA is also present at high levels in kidney and pancreas and at moderate levels in spinal cord, stomach, and pituitary gland. ARHGDIG is mapped to chromosome band 16p13.3 which is rich in deletion mutants of genes involved in several human diseases, notably polycystic kidney disease, alpha-thalassemia, tuberous sclerosis, mental retardation, and cancer.
- Poids moléculaire
- 25 kDa (MW of target protein)
-
Vous êtes ici:
