ANXA8L2 anticorps (N-Term)

N° du produit ABIN634618

Détail du produit anti-ANXA8L2 anticorps

Antigène: ANXA8L2 (Annexin A8-Like 2 (ANXA8L2))

Épitope: N-Term

Reactivité: Chemical

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANXA8L2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Annexin A8-Like 2 antibody was raised against the N terminal of ANXA8 L2

Réactivité croisée: Humain

Purification: Affinity purified

Immunogène: Annexin A8-Like 2 antibody was raised using the N terminal of ANXA8 L2 corresponding to a region with amino acids PDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTET

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Annexin A8-Like 2 Blocking Peptide, catalog no. 33R-7004, is also available for use as a blocking control in assays to test for specificity of this Annexin A8-Like 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ANXA8L2

Antigène: ANXA8L2 (Annexin A8-Like 2 (ANXA8L2))

Autre désignation: Annexin A8-Like 2 (ANXA8L2 Produits)

Synonymes: anticorps ANXA8, anticorps VAC-beta, anticorps annexin A8-like 1, anticorps annexin A8 like 1, anticorps ANXA8L1

Classe de substances: Chemical

Sujet: ANXA8L2 is a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.

Poids moléculaire: 37 kDa (MW of target protein)