Parvin, beta anticorps (N-Term)
-
- Antigène Voir toutes Parvin, beta (PARVB) Anticorps
- Parvin, beta (PARVB)
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Parvin, beta est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PARVB antibody was raised against the N terminal of PARVB
- Purification
- Affinity purified
- Immunogène
- PARVB antibody was raised using the N terminal of PARVB corresponding to a region with amino acids LQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFKELV
- Top Product
- Discover our top product PARVB Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PARVB Blocking Peptide, catalog no. 33R-5302, is also available for use as a blocking control in assays to test for specificity of this PARVB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARVB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Parvin, beta (PARVB)
- Autre désignation
- PARVB (PARVB Produits)
- Synonymes
- anticorps affixin, anticorps beta-parvin, anticorps fd02e01, anticorps wu:fd02e01, anticorps zgc:73117, anticorps CGI-56, anticorps AI595373, anticorps AW742462, anticorps D15Gsk1, anticorps parvin beta, anticorps parvin, beta, anticorps parvin beta S homeolog, anticorps parvb, anticorps PARVB, anticorps parvb.S, anticorps Parvb
- Sujet
- Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.Members of the parvin family, including PARVB, are actin-binding proteins associated with focal contacts.
- Poids moléculaire
- 45 kDa (MW of target protein)
-