TSTA3 anticorps (N-Term)

N° du produit ABIN634621

Détail du produit anti-TSTA3 anticorps

Antigène: TSTA3 (Tissue Specific Transplantation Antigen P35B (TSTA3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TSTA3 est non-conjugé

Application: Western Blotting (WB)

Specificité: TSTA3 antibody was raised against the N terminal of TSTA3

Purification: Affinity purified

Immunogène: TSTA3 antibody was raised using the N terminal of TSTA3 corresponding to a region with amino acids MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TSTA3 Blocking Peptide, catalog no. 33R-6023, is also available for use as a blocking control in assays to test for specificity of this TSTA3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSTA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TSTA3

Antigène: TSTA3 (Tissue Specific Transplantation Antigen P35B (TSTA3))

Autre désignation: TSTA3 (TSTA3 Produits)

Synonymes: anticorps FX, anticorps P35B, anticorps SDR4E1, anticorps AI256181, anticorps Tstap35b, anticorps p35b, anticorps sdr4e1, anticorps TSTA3, anticorps zgc:101805, anticorps si:dkey-235d18none, anticorps Fx, anticorps tissue specific transplantation antigen P35B, anticorps tissue specific transplantation antigen P35B L homeolog, anticorps TSTA3, anticorps Tsta3, anticorps tsta3, anticorps tsta3.L

Sujet: Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.

Poids moléculaire: 35 kDa (MW of target protein)